Caveat verdict
phylo-tree
Phylogenetic analysis tool running local bioinformatics scripts with optional UniProt API for sequence retrieval; executionSinkDetected reflects legitimate scientific CLI usage.
⚠ Flagged for review — coarse, uncorroborated signal, not a confirmed exploit. Review the config yourself before installing.
Automated static analysis — not a human review. Caveat flags capabilities, not confirmed intent, and can produce false positives. Disagree with this verdict? Use Dispute below.
Findings (5)
Instructs covert action — may act without user awareness
references/installation.md · code · quietly
conda install — installs packages via conda
references/installation_quick.md · code · conda install
subprocess execution — runs system commands from Python
scripts/generate_feishu_report.py · prose · downgraded · subprocess.run(
Long base64 string (100+ chars) — likely obfuscated payload
scripts/test.sh · prose · downgraded · MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQT
Python shutil file operation — copies/moves/deletes files
scripts/run_v2.py · prose · downgraded · shutil.copy(
Why the tier is capped
Execution sink present in raw bytes (Hard Floor: class B/D/F). Final tier capped at Caution — cannot be lifted by any downgrade, example-payload opt-in, or allowlist.
Permissions & capabilities
No declared permissions — minimal attack surface.
Is this flag fair?
Thanks — recorded.