Caveat verdict
protein-key-fragment-analysis
Bioinformatics skill for protein sequence analysis using local Python scripts and ClustalOmega; all processing is local FASTA file analysis with no network calls or credential access.
⚠ Flagged for review — coarse, uncorroborated signal, not a confirmed exploit. Review the config yourself before installing.
Automated static analysis — not a human review. Caveat flags capabilities, not confirmed intent, and can produce false positives. Disagree with this verdict? Use Dispute below.
Permission integrity
package_install
Findings (5)
Unicode homoglyph detected — uses lookalike characters to evade pattern matching
references/fibrinogen_domains.md · prose
References sudo — requests elevated privileges
SKILL.md · code · sudo
conda install — installs packages via conda
SKILL.md · code · conda install
subprocess execution — runs system commands from Python
scripts/protein_key_fragment_analysis.py · prose · downgraded · subprocess.run(
Long base64 string (100+ chars) — likely obfuscated payload
scripts/results/Bacillus atrophaeus/Bacillus atrophaeus_key_fragments.json · prose · downgraded · MKHLPAQDEQVFSAIKDERKRQQTKIELIASENFVSEAVMEAQGSVLTNKYAEGYPGKRYYGGCEHVDVVEDIARDRAKE
Why the tier is capped
Execution sink present in raw bytes (Hard Floor: class D). Final tier capped at Caution — cannot be lifted by any downgrade, example-payload opt-in, or allowlist.
Permissions & capabilities
No declared permissions — minimal attack surface.
package_install Is this flag fair?
Thanks — recorded.